PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G039782.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family G2-like
Protein Properties Length: 392aa    MW: 43600.5 Da    PI: 6.385
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G039782.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like69.84.3e-22261305145
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                           k+r++W+ eLH+rFv+a++qLGGs++AtPk+i+elm v+gLt+++
  HL.SW.v1.0.G039782.1 261 KQRRCWSIELHRRFVDAIHQLGGSQVATPKQIRELMRVEGLTNDE 305
                           79****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-8259313IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-18260313IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-15261305IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MFFWNVGERE REVKIMELSL NSGLVFVPKT ISDFLQQVST IRDGSEKLSK LDDYVKRFEE  60
ERRKIDAFKR ELPLCMSLVN DAIARLKEEE KAIKCSGSRD GHAMEEFISL KGNSDEDGST  120
NLADDSSDKK SWMSSAQLWS TNRIEEVVDL HVSEKPIGVS DYRNRGGAFV PFKGQASHCG  180
VVRTSLKEDK ESSLSRVPSL TLMPPTPISE VGGTSDSNPK SSRSCKAGST SSFLTEQVKL  240
VSKPQLVQQT QHQHQQQPFR KQRRCWSIEL HRRFVDAIHQ LGGSQVATPK QIRELMRVEG  300
LTNDEKYRLH VRKVPNSSAE PDSGLWMSQD QCGDSSHQSA SPQGPLAPSG SNKALSHTGG  360
DSTEVEEEEE DEKSDGHSWR GGNHNKAGED V*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890038.11e-131PREDICTED: uncharacterized protein LOC107424698
TrEMBLM5WFN31e-125M5WFN3_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00060.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-58G2-like family protein